PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g07320.1
Common NameLR48_Vigan08g212000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 685aa    MW: 76819 Da    PI: 4.8053
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g07320.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.62.4e-22200253155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W ++L ++F++av+ L G+e+AtPk+ile+mk +gL ++hv+SHLQkYR 
  Vang05g07320.1 200 KPRVVWDEKLNASFINAVNIL-GIENATPKKILEIMKEPGLERSHVASHLQKYRN 253
                     79*******************.********************************6 PP

2Response_reg63.41.1e-21261353111
                     EESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
    Response_reg   3 ivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                      +d + +v+e +++ ++++g+ +v ++++ ++a+  l+e++  +Dlil+ ++mp m+G+e+l+ i++e+ ++p i++++ ++++ +++a+k Ga 
  Vang05g07320.1  26 AIDTNLTVLEFIKNTCNQDGI-RVLACSEYQSAVIALRERKqhIDLILTEVDMPIMNGYEFLEFIKKEQVNVPLIMMSSDDSMSSRVRAIKHGAC 119
                     5788999**************.999999999999999555555**************************************************** PP

                     EEEESS--HHHHHHHH CS
    Response_reg  96 dflsKpfdpeelvkav 111
                     d+  Kp ++ +l +++
  Vang05g07320.1 120 DYWIKPLHEFHLKNKL 135
                     ******9988887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.13E-2621147IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.1E-2722153No hitNo description
SMARTSM004483.9E-1922135IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.94723139IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.1E-1824135IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.07E-1627139No hitNo description
Gene3DG3DSA:1.10.10.602.8E-22198257IPR009057Homeodomain-like
SuperFamilySSF466891.25E-13198257IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-21200253IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MAKFGSPTTH IEDTVPQVPS ALTIVAIDTN LTVLEFIKNT CNQDGIRVLA CSEYQSAVIA  60
LRERKQHIDL ILTEVDMPIM NGYEFLEFIK KEQVNVPLIM MSSDDSMSSR VRAIKHGACD  120
YWIKPLHEFH LKNKLTRVFQ KKCMIADKLQ KDSGCLKDDD KRRGRSDNSE LASCMVHWSN  180
SNFEEADVVD ESCNPPPTKK PRVVWDEKLN ASFINAVNIL GIENATPKKI LEIMKEPGLE  240
RSHVASHLQK YRNSLRKEQK KNMSCDPETQ IQQQQPQQND MFFISGRQIE QQHSQQKQND  300
MPLVSGRQIE QPQSEQNDMS WNTEPRMSAV ERVHLQPCSA TTMTGNMVEE ALANIQLADS  360
FHAEETLAHD LPLASFPNFA SNQNFQLGTL DDASLWKLFC PSDAEIVDDL IMQMINNMDV  420
QQQNDMSFNS GRQIQQPQQN DMSLVSGRQI EQQQSHQNDM SLPRTSALQP FSATAMTIFH  480
PGFTGNMEEE ALAYGHPLAA FPNVVIPENF SEEQSNPNRQ LANNFIAEQV LAHDLPLATF  540
PNIASNQNSQ LGTLDDASLY GSLYPFDTPL FDNPTMLQTD NMQQSMHHNQ MYPMNFEPSS  600
TIISGNPAFA SQNYNFGMNM GHGSQSIQDG SSIGEGILDQ YSTIDSIYHP QFQNAGLPSG  660
AARRFVASNS SSQNPSVDDK SSQK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521383.10.0PREDICTED: uncharacterized protein LOC106778015
TrEMBLA0A0L9V8G50.0A0A0L9V8G5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SET20.0A0A0S3SET2_PHAAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2069324
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.11e-41response regulator 14
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]